PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01191.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 472aa    MW: 53503.1 Da    PI: 6.8469
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01191.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.4e-132973348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W++eEd++l + +  +G+++W+ Ia+++   +t  qc+ rw++yl
       KHN01191.1 29 TWSQEEDDILREQIGVHGTENWAIIASKFK-DKTTRQCRRRWYTYL 73
                     6****************************9.*************97 PP

2Myb_DNA-binding45.91.3e-1479122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd+ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
       KHN01191.1  79 KGGWSPEEDKLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFST 122
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9122273IPR017930Myb domain
SMARTSM007171.4E-122675IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-2526120IPR009057Homeodomain-like
CDDcd001675.76E-122973No hitNo description
Gene3DG3DSA:1.10.10.609.3E-203080IPR009057Homeodomain-like
PfamPF139213.3E-153090No hitNo description
PROSITE profilePS5129420.70274128IPR017930Myb domain
SMARTSM007174.9E-1578126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-2081127IPR009057Homeodomain-like
CDDcd001678.10E-1182123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MQDIKKQQDK QKKQMVNEES KKKERHIVTW SQEEDDILRE QIGVHGTENW AIIASKFKDK  60
TTRQCRRRWY TYLNSDFKKG GWSPEEDKLL CEAQKIFGNR WTEIAKVVSG RTDNAVKNRF  120
STLCKKRAKY EALANENNTS YINSNNKRIF LQHGCDTDVA SESAIKKMRR SHISDATEKI  180
NFGDRSHKQN GILLNQQSRA PFAVLAQNSH NVNLPDQHRV CNLKFSDYAQ NNKIQGTFLK  240
KDDPRINTLM QQAELLSSLA LKVDAENMDQ SLENAWKVLQ EFLNRTKELD IPRYKIPDLQ  300
LVDLKDLLAD LKSSSEEIQP CWRPVELYED SPGSSEYSTG STLMPHSAGE DLEHSLHQDI  360
GTELNIQIGD PEGVRGCDQG ILSSATLNQD LFSSSEEQIN NDGIVSALSR SEFSSPLQVT  420
PLFRSLAAGI PSPQFSESER SFLMKTLGME SPSLNPSANP SQPPLCKRAL LI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-273012710107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1813DKQKKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150439e-66AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006573101.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_006573102.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A0B2NVM00.0A0A0B2NVM0_GLYSO; Myb-related protein B
TrEMBLK7K1S10.0K7K1S1_SOYBN; Uncharacterized protein
STRINGGLYMA01G05190.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.21e-165myb domain protein 88
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]